Delfines-Facturas de Semana del 17 Inactiva y Notas previas al partido

Publicidad

03 de enero de 2021 a las 11:41 AM

Travis Wingfield

Escritor

El 53-el hombre de la lista se ha ampliado en virtud de la revisión de CBA. Los equipos ahora pueden activar hasta 48 jugadores el día del juego, en comparación con los 46 jugadores anteriores. Existe una estipulación: los equipos deben tener ocho linieros ofensivos activos para vestir a 48 jugadores; de lo contrario, se permitirá que el equipo tenga 47 jugadores activos.

los Delfines Inactiva

Inactiva para #MIAvsBUF. pic.twitter.com/LuxyOTVGMp

– Miami Dolphins (@MiamiDolphins) Enero 3, 2021

Billetes Inactivos

Los inactivos de hoy. # MIAvsBUF pic.twitter.com/2ij9it4oeF

– Buffalo Bills (@BuffaloBills) Enero 3, 2021

Resultados Rápidos de la Lista

Delfines

Los Dolphins están recuperando a un puñado de jugadores para el final de la temporada regular de hoy.

Después de perderse los dos últimos partidos, DeVante Parker está activo. Sus 677 yardas receptoras lideran a Miami y es el único jugador en la ofensiva de los Dolphins hoy que estuvo en el campo para la victoria de 2016 en Buffalo en Nochebuena. Parker atrapó cuatro pases para 85 yardas y un touchdown en ese juego.

El extremo defensivo Shaq Lawson está activo y listo para su primer partido en Buffalo desde que firmó con Miami esta temporada. Lawson jugó los primeros cuatro años de su carrera con los Bills.

El guardia novato Solomon Kindley está de vuelta después de perderse el partido de la Semana 16. La última vez que Kindley y Flowers estuvieron disponibles, la línea ofensiva inicial fue Austin Jackson-Ereck Flowers-Ted Karras-Solomon Kindley-Robert Hunt.

El receptor Jakeem Grant está inactivo hoy.

El apoyador Kamu Grugier-Hill no viajó con el equipo con una enfermedad y se perderá el partido de hoy.

Facturas

Buffalo será sin receptor de ancho Cole Beasley. Atrapó 82 pases para 967 yardas en 15 juegos esta temporada. Tight end Reggie Gilliam también está fuera.

Tres de los jugadores defensivos más productivos de Buffalo están inactivos, incluido el cornerback Tre’Davious White, un All-Pro en 2019. El apoyador Jerry Hughes, que tiene 4,5 capturas este año, y el extremo defensivo Mario Addison, que está empatado en el liderato del equipo con cinco, también están inactivos.

El guardia Jon Feliciano entrenó el viernes después de perderse las prácticas del miércoles y el jueves y está activo para el juego de hoy.

El receptor John Brown está de vuelta después de perderse los últimos seis partidos.

Hilos

Los delfines están en sus blancos de carretera con fondos de agua, mientras que las facturas de alojamiento usarán sus tops azules y fondos blancos.

Tiempo

El pronóstico en Búfalo indica temperaturas de 36 grados, un cielo nublado, un 20 por ciento de probabilidad de lluvia y vientos de 5 MPH.

Publicidad

Facebook Instagram logo Facebook logo de Snapchat logo de YouTube Logo de TikTok Logo de Spotify Icono de ubicación Icono de correo Icono de menú Icono de Abrir Icono de teléfono Icono de Reproducción Icono de Radio Icono de rebobinado Icono de flecha derecha Icono de búsqueda Icono de Selección Icono seleccionado TV Icono de teléfono Icono de teléfono Icono de rebobinado Icono de teléfono Icono de ubicación Icono de enlace Icono de ubicación Icono de teléfono Icono de teléfono Icono de teléfono Icono de rebobinado Icono de flecha derecha Icono de búsqueda Icono de selección Icono seleccionado Icono de TV icono Logotipo de Twitter Logotipo de Twitter Icono de flecha hacia arriba Icono de usuario Icono de audio Icono de tickets Añadir a icono de calendario Icono de FC icono de AFC Icono de NFL Carrusel de iconos Vista de la lista de páginas web InstagramTwitterFacebookSnapchatShop Icono de la tienda Icono de la compra Superpuesto AvatarAddAirplayArrow LeftArrow UpArrow DownAudioBack 5sBack 10sBack 30scalendarchartcheckdownleftrightcromecast OffChromecast Oncloseclosencabezados OffBench OnBroad Offroad OnVertical OffVertical Oncomentdockdonedownloaddraft Fantasyfilterforward 5sForward 10sForward 30 Pantalla completa OffFull Screen Ongamepassgamesinsightskeylevelivecombinedraftfantasymenu GamesMenu Redmenu Noticiasmenu Playoffs Menu Pro Bowl ShopMenu StandingsMenu StatsMenu Super BowlMenu Teamsmenu Ticketsmenumás horizontalmás VerticalMi Locaciónnewspauseplaymultiple Playerslist de jugadospro Bowl Purgerefreshremovereplaysetiquingshare AndroidShare Copy URLShare EmailShare FacebookShare InstagramShare iOSShare SnapchatShare Twitterestandasestatos inicialescartetas de equipos de Wapvidovisibilidad de la visibilidad en volúmen Hivolumen bajo volúmen medio Mudo de volúmenwarn Cuidado de la página web downCaret upAt