Dolphins-Bills săptămâna 17 Inactives și Pregame Notes

publicitate

Jan 03, 2021 la 11: 41 A. M

Travis Wingfield

scriitor

lista de 53 de oameni a fost extinsă în cadrul ACB revizuit. Echipele pot activa acum până la 48 de jucători în ziua jocului, în creștere față de 46 anterior. Există o prevedere: Echipele trebuie să aibă opt linieri ofensivi activi pentru a îmbrăca 48 de jucători; în caz contrar, acelei echipe i se va permite să activeze 47 de jucători.

delfinii inactivi

Inactives pentru #MIAvsBUF. pic.twitter.com/LuxyOTVGMp

– Miami Dolphins (@MiamiDolphins) ianuarie 3, 2021

facturi inactive

inactivele de azi. # MIAvsBUF pic.twitter.com/2ij9it4oeF

– Buffalo Bills (@BuffaloBills) ianuarie 3, 2021

lista hit-uri rapide

delfinii

delfinii primesc o mână de jucători înapoi pentru finalul sezonului regulat de astăzi.

după ce a ratat ultimele două jocuri, DeVante Parker este activ. Cei 677 de curți de primire conduc Miami și este singurul jucător din ofensiva delfinilor de astăzi care a fost pe teren pentru victoria din 2016 la Buffalo în Ajunul Crăciunului. Parker a prins patru pase pentru 85 de metri și un touchdown în acel joc.

sfârșitul defensiv Shaq Lawson este activ și gata pentru primul său joc în Buffalo de când a semnat cu Miami acest offseason. Lawson a jucat primii patru ani de carieră cu facturile.

Rookie guard Solomon Kindley se întoarce după ce a ratat jocul din săptămâna 16. Ultima dată când au fost disponibile atât Kindley, cât și Flowers, linia ofensivă de start a fost Austin Jackson-Ereck Flowers-Ted Karras-Solomon Kindley-Robert Hunt.

receptorul larg Jakeem Grant este inactiv astăzi.

Linebacker Kamu Grugier-Hill nu a călătorit cu echipa cu o boală și va pierde jocul de astăzi.

facturi

Buffalo va fi fără receptor larg Cole Beasley. El a prins 82 de pase pentru 967 de metri în 15 jocuri în acest sezon. Sfârșitul strâns Reggie Gilliam este, de asemenea, afară.

trei dintre cei mai productivi jucători defensivi ai lui Buffalo sunt inactivi, inclusiv cornerback tre ‘ Davious White, Un All-Pro în 2019. Linebacker Jerry Hughes, care are saci 4.5 în acest an, și sfârșitul defensiv Mario Addison, care este legat de conducerea echipei cu cinci, sunt, de asemenea, inactivi.

Gardianul Jon Feliciano a practicat vineri după ce a ratat atât antrenamentele de miercuri, cât și cele de joi și este activ pentru jocul de astăzi.

receptorul larg John Brown se întoarce după ce a ratat ultimele șase jocuri.

Fire

Delfinii sunt în albii lor de drum cu fundul aqua, în timp ce facturile de găzduire vor purta vârfurile lor albastre și fundul alb.

Vremea

Prognoza Din Buffalo solicită temperaturi de 36 de grade, un cer înnorat, șanse de ploaie de 20% și vânturi de 5 MPH.

publicitate

pictograma săgeată mare stânga pictograma săgeată mare dreapta pictograma Închide pictograma copie URL pictograma trei puncte pictograma săgeată în jos pictograma E-mail pictograma E-mail ieșire pictograma pe tot ecranul pictograma link extern Facebook logo pictograma fotbal Facebook Logo Instagram logo Snapchat logo YouTube Logo Tiktok logo Spotify logo LinkedIn logo grilă pictogramă cheie pictogramă săgeată stânga pictogramă Link pictogramă locație pictogramă e-mail Pictogramă meniu pictogramă deschisă pictogramă telefon pictogramă redare pictogramă Radio pictogramă Derulare înapoi pictogramă săgeată icon Twitter logo Twitter logo Up arrow icon User Icon audio icon Tickets Iconadd to calendar iconNFC icon AFC icon NFL icon carusel Iconlist ViewWebsite InstagramTwitterFacebookSnapchatshop IconProfile Overlay AvatarAddAirplayArrow LeftArrow RightArrow UpArrow DownAudioBack 5sBack 10sback 30scalendarchartcheckdownleftightupchromecast OffChromecast OnCloseClosed CaptionsBench OffBench onbrand Offbrand onvertical offvertical oncommentdockdonedescărcaredraftfantasyfilterforward 5sforward 10sforward 30secran complet Offfull screen Ongamepassgamesinsightskeyleavelivecombinedraftfantasymenu Gamesmenu NetworkMenu NewsMenu PlayoffsMenu Pro BowlMenu ShopMenu StandingsMenu StatsMenu Super BowlMenu TeamsMenu Ticketsmenumore HorizontalMore VerticalMy Locationnetworknetworkspauseplaymultiple PlayersSingle PlayerPlaylistPlayoffsPro Bowlpurgerefreshremovereplayscăutare Setărihare AndroidShare Copy URLShare EmailShare FacebookShare InstagramShare iosshare snapchatshare Twitterstandingsstarstatsswapteamsticketsvideovizibility Offvisibility Onvolum Hivolum Lowvolum Mediumvolum Mutewarningwebsite Caret Downcaret upat